DPCstruct | MC22113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 204 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833HGG9 | 1-201 | PAAAATPARPLPPLDASDAFVREAAALLSTRAELASWLAHEGLVRRYVAVVANVAEGASPAPHVGFLRPAGGFTTLGGANEATVDPA… |
| E7RZ83 | 197-388 | VAPADAGEAAVNKELAKNWPLAQLRKYFNLQEQARRLVITVDNLPREHVPSQLRVTRGVPELLRVKKEGETITLDPSNYERYDRIIG… |
| A0A483A3R4 | 93-292 | None |
| A0A1V6FHM4 | 9-178 | None |
| A0A1H7WPE2 | 146-361 | None |
| A0A7Y1W0Q1 | 21-256 | None |
| A0A1R1LRZ7 | 230-425 | None |
| A0A2G4JG47 | 61-271 | None |
| A0A3P3ZR79 | 150-349 | None |
| A0A3E0WN71 | 44-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.