DPCstruct | MC22111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 75 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7RVV8 | 24-82 | HRYHRGDRLPPEARQSVMVVQDWRDHRLDPPPRGHDWVRLGSDFVLVAAATGIIAQVIL |
| A0A840Z0A2 | 30-96 | WRAPFRYHHFRSGMRIRHIYFGSRYYISDPWYYRLPPAGPYRRWVRHYDDVMLVDIRTGYILRIYYN |
| A0A7W6PUR3 | 107-167 | None |
| A0A068YP23 | 348-448 | None |
| A0A6P1YNW8 | 74-134 | None |
| A0A7Y4WEI4 | 6-77 | None |
| A0A4R6AXV4 | 14-91 | None |
| A0A317ZHW8 | 90-192 | None |
| A0A523NUJ4 | 419-520 | None |
| A0A4R4D5Y2 | 13-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.