DPCstruct | MC2211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 16.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8ZER6 | 5-157 | ITAWAQRAGYHSTDDADALVLYSEGGENRYYVRERQDGWWELSFASRGEDERFMLRASSREVLEHHLVEVFGVTIRDEAALPFLRLP… |
| A0A4R5X0T5 | 5-145 | GHSRATILWSDPGGEIRFYIRRRFDGHFVLTSSERASDEQFELSAPAAETLEKHLFGLLGSDARSQKGLPRLQLPTHLEAVATGFRI… |
| A0A1S1NKN7 | 83-279 | None |
| A0A4U0QFJ0 | 22-182 | None |
| A0A7Z9E6W3 | 11-178 | None |
| A0A7I7XYW9 | 126-283 | None |
| A0A2W1UE63 | 2-118 | None |
| A0A117N948 | 317-483 | None |
| A0A7W3R5P8 | 2-164 | None |
| A0A7W3MRS1 | 23-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.