DPCstruct | MC22109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 483 ± 32 aa |
| Standard deviation of domain lengths | 32.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2CK26 | 42-519 | PQAMFPPLSLVDGGRVPAQVMLGVVAQESNLWQASRLAYPGVTGNPLIGNFYGLIYNDREDDDWTIRWSEADCGYGVAQVTDGMRRA… |
| A0A1Q4YBH7 | 12-499 | AQGLFPPTALDGGGHVPAQVLLGIATQESNTWQAAKFAVPGMTANPLIGNYFGIDYYNGDEGDDWTIRWDKADCGYGVMQITDGMRL… |
| R1I5M4 | 498-974 | None |
| A0A1H2JKQ5 | 446-941 | None |
| A0A419I5E6 | 6-500 | None |
| A0A4S2TXS2 | 5-453 | None |
| A0A4S2TGW5 | 152-655 | None |
| U2RXV8 | 9-424 | None |
| A0A2M9LWX4 | 372-809 | None |
| D6M5D6 | 46-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.