DPCstruct | MC22108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6CN65 | 19-127 | DRVLGQILRKAVWDRLDLLDELVSDADNRSLLSVARGELPRLISGWRALLATHAPDSRGRCPECSHPWRPRVAPCRVWRTAHEHLVA… |
| A0A1Q4Y9S8 | 4-123 | ALRAAVLRRLALLDEAAETGEAEALVPLARSEIHRLADGWRLLLTVHQPDPDGRCGACPGILRHKKWPCQVWTMAHQHLIGDGLPHR… |
| A0A5Q3QGM4 | 2-106 | None |
| M2PKL0 | 2-108 | None |
| A0A2W6CLW0 | 1-102 | None |
| A0A840NU40 | 4-128 | None |
| A0A099D1N0 | 4-134 | None |
| A0A1Y5XX69 | 4-110 | None |
| K0KDY3 | 51-181 | None |
| A0A263CX42 | 35-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.