DPCstruct | MC22106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 176 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1LTF2 | 202-398 | ADWEAKEQAAWDAERAAFTPEALALADHLVCCGLTLTTSSGLACGHGNTYVLAADAPVALWLREALEGAVFSGPEGPWPNWGRTCHA… |
| A0A1H4I5U5 | 1-190 | MTEATSIELARLRQTGYLYQSTDYVEAFSVPALRLAERLWEDVTGFHNGPYFLPESSPLPGWFLAAVRGFPIRGVEAGWPQFARYWD… |
| A0A1M6GVS6 | 208-387 | None |
| A0A4R1F7L4 | 19-171 | None |
| A0A4Y4B8Q1 | 24-208 | None |
| A0A851HM77 | 23-200 | None |
| A0A5N5V6C5 | 142-303 | None |
| A0A7K2V9Z1 | 86-270 | None |
| A0A318RVA0 | 39-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.