DPCstruct | MC22104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 137 ± 21 aa |
| Standard deviation of domain lengths | 21.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.14 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | CL0633- PF00885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433VTJ6 | 3-121 | NPRQLAFIALKAVHRDAYADVALDRVLSQSNLNPNDRRLVTELVYGSVRRMRSLDVLIDRLAKKKSHQQPPDLRTILHIGLYQLCYL… |
| A0A7X7AEF9 | 6-136 | ARETALMVIFQMDLVKAELQDALDFVLQEFAVQPSAIDYARELASGVWEYRENLDGLIQRESTEWEVSRMAVVDRNILRLAVYEMFI… |
| A0A7T8XQM2 | 413-560 | None |
| A0A445C2Z3 | 57-217 | None |
| I5AUS3 | 12-169 | None |
| A0A3T0Y5Q5 | 2-132 | None |
| A0A5N9AXH6 | 2-133 | None |
| A0A011N4I7 | 22-179 | None |
| A0A1I5U7U7 | 3-142 | None |
| C8PI00 | 4-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.