DPCstruct | MC22101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2595 |
|---|---|
| Mean domain length (aa) | 118 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.68 |
| Pfam Score | 75.27 |
| Assigned Pfam label(s) | CL0020- PF19649- PF21537- PF09329- PF03843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645GK07 | 52-150 | PVTAATIAEVLTKPDSNQDYYMVTGEITSIKDAIYGNLYLKDGDSEIYLYGCYPGYGATGDYRKNLLADKGIKVGDKLTVIATKSSY… |
| A0A2N6BEU8 | 12-131 | VFAVSLPLTSIAAKEYTPSSQAELTRNMDDFLEKDVSIEGTFLFTGSDFCYQIRKTKINTRDYFCFALGPVNLIRFYLKKNHIQVPE… |
| A0A2N5YL01 | 255-354 | None |
| A0A164YC77 | 461-574 | None |
| A0A164MGT8 | 4-86 | None |
| A0A6A6LI94 | 359-449 | None |
| A0A2H6KAD4 | 10-126 | None |
| A0A164Y9N6 | 346-454 | None |
| A0A843MDE0 | 20-115 | None |
| A0A3R6LNY5 | 121-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.