DPCstruct | MC221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 323 ± 61 aa |
| Standard deviation of domain lengths | 60.52 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | CL0290- PF05189- CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0UHH2 | 1-249 | GSTTLVLQALIPPLILQQGVSRITLTGGTHVPHSPCFHYIKEVFLSFLGMLGIHVEAGIEMFGFYPKGGGRIWAEVRPAKEIRGIFI… |
| T0PP94 | 281-624 | APVSIDGSLYEGGGQILRLAAPLAVLCNVPLTVHSIRHNRPKPGLARQHLGGLELLQTISQASFEGLALLSTSVSLRPSASPPTGTS… |
| A0A812ZJ10 | 541-905 | None |
| A0A7X9DER5 | 2-201 | None |
| A0A3Q0J3N4 | 24-287 | None |
| A0A182TEE6 | 12-346 | None |
| A0A1A9X5W6 | 7-349 | None |
| A0A834XTE7 | 3-267 | None |
| A0A1X6PF18 | 154-482 | None |
| A0A0D2NRS0 | 8-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.