DPCstruct | MC22095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19854 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2LN57 | 6-104 | GRKIGDLTELEVLTEQAIKSRQQGQSYCVIKEVLLEDDQFHSFANDFFNDQPWITEEDGGVNENREVRCIRVINQDTGEKILVNNEG… |
| A0A316QSI0 | 9-105 | KIRFNSKDPAPDVKPFRLRAVEILDENQWAVFSNRLLDDYDFIAKHSDALCVGSDGVTNALLVLNKQTEEGILVNSEGSSYARYSAY… |
| A0A6G7ZCE8 | 82-178 | None |
| A0A6M6I9X3 | 101-199 | None |
| A0A1Y3RVX3 | 2-85 | None |
| A0A449BEU3 | 1-101 | None |
| A0A2P5N167 | 1-80 | None |
| A0A0S2FHS9 | 16-91 | None |
| A0A096DA96 | 4-99 | None |
| A0A510Y1F0 | 8-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.