DPCstruct | MC22092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 506 ± 37 aa |
| Standard deviation of domain lengths | 36.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9M6D5 | 108-616 | TYELNFNQGPDSTIDASDNFQLKQYIGRPLQMLGKTYLIFDARTGGANSHKVSLRLLENPSFEIMGEGESRNNVTIISVDPELRRAT… |
| A0A7C5DG96 | 142-585 | SELNKFHLPQVLRSGRLSSNTEAFGLRAAMYEQFLKLRSGSVVFGFDENTERTTTYLSFKEGQPILNYRLELYNGIFKFFEGETINL… |
| A0A5E4JVG3 | 316-825 | None |
| A0A2D6R7Q6 | 1-515 | None |
| A0A0B3ARM6 | 183-733 | None |
| A0A2D6R7R0 | 291-777 | None |
| A0A1J4Y2F1 | 95-642 | None |
| A0A7C5DFY1 | 107-661 | None |
| A0A2D6EXR6 | 16-472 | None |
| A0A2G9NFZ8 | 146-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.