DPCstruct | MC2209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 91 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5E8R0 | 1-69 | MSIVEQIDEILQRLLASTPFAGQVRLREQVGGGIDIWVGAKRYTAVDEVAEAEVKAALRAAIAEWERHA |
| A0A7V2L7S8 | 17-91 | ESDELQASPVSEKIEDLVKQKLQEHSDLRDVVIDFGTSLDGSLEIWIDSERYLNVEDIPDERIRKAIGEAVEDFN |
| H5S8Q5 | 113-207 | None |
| A0A212RQZ1 | 99-177 | None |
| A0A1F8PCJ6 | 7-126 | None |
| A0A2G6GIK8 | 119-219 | None |
| A0A350WTW4 | 17-144 | None |
| A0A7V2Q7V0 | 90-179 | None |
| A0A0P6YD31 | 162-257 | None |
| A0A7C4VUG5 | 276-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.