DPCstruct | MC22089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 7.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5C086 | 165-226 | NRVLDVNDRFLRKITVGQNPTEQGHARETGFDIAVASECMAVLALSNSLADMRERLGRMVVA |
| B9T080 | 88-146 | LDIDPDSITWRRVMDVNDRFLRKITIGQGPEEKGMVRETGFDISVASEIMTVLALQHLF |
| A0A0N4VKP1 | 56-123 | None |
| A0A101I5C9 | 234-290 | None |
| A0A0D8XDL0 | 57-113 | None |
| A0A090QZ22 | 176-235 | None |
| A0A327XVL9 | 30-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.