DPCstruct | MC2208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399YMW3 | 2-71 | KHAGDKAFILRNGVWTDTTFVPEKMTTTKIQFGSQQYFDLLAQHPEWNKYVAVGERVIFVVNGVAYEITA |
| A0A7V1NTQ1 | 1-74 | MVRHVGNKTFILREDVWTDTTFDPETMAPVQVGFGTEAYFDLLAARPEWGEYLALGSRTLFVAEGTAYEVVEGE |
| A0A7Y4SV25 | 302-389 | None |
| A0A838U7T7 | 3-73 | None |
| A0A7W1JFT9 | 55-143 | None |
| A0A3D0N497 | 19-109 | None |
| A0A7Y3I484 | 35-134 | None |
| A0A317I4V2 | 18-96 | None |
| A0A0N8WB15 | 156-238 | None |
| A0A2G6KC13 | 208-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.