DPCstruct | MC22077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 166 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1EBG3 | 161-283 | PVYECTFGFLGCRFFTAGDEEHWRTHNLSHFHGYAPPRQVECPLCDFGFEDARDGHRAWAARMSHLAAHMRLGQTMDASRPDFRLYQ… |
| A0A094DWJ8 | 1-184 | MLINISSLPCIFQDILACQHINFDDPDSWSGHVIGHFGPSGPPPHALCIFCDKSFEDDNAATCWNGYLDHINEHFKDGRALDRRPDF… |
| A0A5M9J6Q0 | 1-181 | None |
| A0A218Z0K6 | 101-285 | None |
| A0A6V8H8X6 | 90-297 | None |
| A0A4Z0Z6E7 | 476-641 | None |
| A0A0B4GU49 | 493-657 | None |
| A0A1L7XD50 | 775-987 | None |
| A0A420YI20 | 443-609 | None |
| A0A2K0US17 | 92-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.