DPCstruct | MC2207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 198 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5YZG0 | 63-278 | PGFWGAGVCHRIVERSFSISGQTLPLCARCTGIYLAFFSTAVMGGRRRPAAFPPPGILLFLLLFLVLAGLDGLNSYLAFFPTLPHLY… |
| A0A7V0YEF0 | 19-219 | RGRVQRSMSVVQLFEILRFLGGGVCHQLPERSLRLGGVTLPLCARCTGTYLGALGAMAAVALLRRARASLLPSWRVLALFGSFFVAW… |
| A0A7C3Z4F4 | 51-243 | None |
| A0A832X5Z3 | 1-179 | None |
| A0A7C4BGR2 | 6-187 | None |
| A0A3L7VZJ5 | 28-211 | None |
| A0A0S8J3T2 | 2-196 | None |
| A0A7C2RT99 | 2-216 | None |
| A0A1G1MWU4 | 1-199 | None |
| A9B629 | 66-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.