DPCstruct | MC22067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829X957 | 11-76 | LSTFLSGQVGVNTSNPQGAFHIDGAKDNPALDSPLSSQQLNDFIVTANGNVGAGTTTPNTYAKLDV |
| A0A0Q4DV99 | 1-75 | MIMKKLILLIAGISFVPVYSQVGINTGNPTGIFHVDGAKDNAVTGIPTLTQQANDFVVTSNGSIGIGTVSPNASA |
| A0A1M4TKI5 | 1-87 | None |
| A0A2R7P608 | 1-71 | None |
| A0A1M5F6T8 | 18-93 | None |
| A0A1I0P9R5 | 1-70 | None |
| A0A3G2GCC2 | 1-73 | None |
| A0A511YBZ3 | 1-84 | None |
| A0A1W2CFQ4 | 89-171 | None |
| A0A202CCS7 | 10-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.