DPCstruct | MC22065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5AH59 | 14-81 | LNTIGVANLPFDRHDWIVDRNGTEVRYVIDFYSGQPVPGKPLSVYMDVRPALDTVQNAVDRVRMQFHK |
| A0A5B7EUY3 | 42-110 | YKYELPFDRHDWIVDRCGKEVRYIIDYYDGGPVDPESHSFAILDVRPAMDSFENVWDRMVVAWWRWTKK |
| A0A6A4JYP2 | 34-104 | None |
| A0A7S2XZW3 | 121-214 | None |
| A0A3N4IVY3 | 20-79 | None |
| A0A3S1BIX1 | 325-403 | None |
| A0A061RAZ0 | 182-269 | None |
| A0A835Y2D2 | 213-289 | None |
| A0A7S3BJK8 | 89-156 | None |
| A0A4Q4U243 | 737-817 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.