DPCstruct | MC22061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 360 ± 44 aa |
| Standard deviation of domain lengths | 44.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF00557- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7E4X5 | 1-320 | MDKRTCKEDQDEAVFGTGIEFRESALLIGPKNTTVAKKGQVFNVNLGFSDLINPDASGSSKKYALFIGDTVVVNEEQAATILTATSK… |
| A0A6A4J300 | 151-538 | GIEFREGSLVIGPKTQAKVLKNHVYNLNVGLSGLTNKEAKESEGKTYALFIGDTIVVNEGSPPTVLTQSRKKMKNIGIFLKDGEEED… |
| A0A7S0QUN9 | 370-748 | None |
| U9U0Z2 | 1-387 | None |
| A0A2I3H210 | 1-363 | None |
| A0A5J4NZ93 | 193-616 | None |
| A0A453AGZ3 | 370-745 | None |
| A0A453AH07 | 32-407 | None |
| A0A7S3EIK3 | 94-480 | None |
| A0A6G1BL86 | 1-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.