DPCstruct | MC22060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 52.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0T275 | 1-105 | MEERYGEKGKAIRIEKVIYTGKEGKSSRGCPIAKWVIRRHNQEEKLLCLVRHRAGHHCQNAVIIILILAWEGIPRTLGDTLYQELTD… |
| A0A5B7E415 | 1-92 | MGKAIRIEKVTYTGKEGKTESGCPLAKWIIRRSGPEEKTLALVKHRSKHTCSTSWIVIALVAWEGVPLNIADDMYSTMVYKLNKFGT… |
| A0A6J2Y487 | 110-201 | None |
| A0A3L7IEU6 | 52-123 | None |
| K1P567 | 424-513 | None |
| T1KWD2 | 35-124 | None |
| A0A482WML7 | 1-92 | None |
| A0A482WJW3 | 62-164 | None |
| A0A182TII0 | 19-110 | None |
| E9H3N0 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.