DPCstruct | MC2206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 125 ± 24 aa |
| Standard deviation of domain lengths | 24.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0V1Q8 | 2-111 | AGPAFEGAGVRSGMRAIPGAIDEVWINPRTFEPTFRTIGGEAPRGICGSGLISLLAEMLVTGVVDKSGRLNRSLPTPRIREGEHGPE… |
| A0A7Y3GL05 | 2-160 | LGNRHKLISSSCATGPALEGAQIAFGMRAAPGAMERIEIDPETKEVDYKVIGREAWRKYSEPKEMKAKGICGSGILDLLAELYRSGV… |
| A0A7K2BMX2 | 142-284 | None |
| A0A0L6JQB6 | 305-441 | None |
| A0A0P1J298 | 813-972 | None |
| A0A7X7ETJ6 | 161-306 | None |
| A0A1F9DQ12 | 894-1034 | None |
| A0A7X3KR13 | 4-126 | None |
| A0A1J5AK14 | 536-692 | None |
| A0A1V5C800 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.