DPCstruct | MC22058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 385 ± 111 aa |
| Standard deviation of domain lengths | 110.86 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 30.97 |
| Pfam Score | 91.81 |
| Assigned Pfam label(s) | PF20235- PF12274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368SCI7 | 2-375 | PRRARRLLTSYFRYLTAWEALYYLRRSRADLLVAVHLVEEDHATRGFALDHPTTKVALACAARSAMHPRPDAFMSASVSLASRRRQM… |
| A0A453JKZ2 | 59-391 | SDVCLGVCVGLLDPVSNIIASTLLAAAEAPVDTGGPTAVDGPRLRDMERRSLDGLVAFLTCFFPYLADWEAVRYLLLAEADPIVAAR… |
| R7VZ06 | 2-413 | None |
| Q5Z8Y1 | 214-476 | None |
| B8BGG6 | 91-332 | None |
| A0A0A9PJM5 | 34-443 | None |
| A0A835A1L8 | 9-490 | None |
| A0A835A7P4 | 31-322 | None |
| A0A3L6TC23 | 2-282 | None |
| A0A835AA50 | 16-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.