DPCstruct | MC22057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 52 ± 4 aa |
| Standard deviation of domain lengths | 4.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 71.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DIL5 | 9-57 | MIPFRESRPLGADLILENVAMRFLKDSAVPLVNDWGSCVGIVHSRDCTK |
| A0A287RHV4 | 1-49 | MIPFRESRPLSADLILESVAMRFLKDSAVPLVNDWGSCVGIVHSRDCTE |
| A0A453DIK6 | 200-256 | None |
| A0A453DIK3 | 157-204 | None |
| A0A2R6Q2U1 | 69-116 | None |
| A0A453DIK0 | 69-117 | None |
| A0A446T394 | 109-157 | None |
| A0A803P362 | 158-214 | None |
| A0A0E0B3B1 | 231-287 | None |
| A0A5D3E6U0 | 1025-1081 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.