DPCstruct | MC22055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078I0A6 | 725-818 | WNEVFAFTKSDQQANFVDVIVMDKGVMKDNFVGSIRFDLNEIPTRVATDSPIAPEWYIVNHERGGEIMLSVWFGTQADEAFSDATYS… |
| A0A6A6LCK4 | 330-422 | WNQIFAFSKDRLQANLLEVTVKDKDIVKDDFVGRLLIDLSEVPLRVPPDSPLAPQWYKLEDRKGDKINKGEIMLAVWMGTQADESFP… |
| A0A498IHI1 | 317-415 | None |
| A0A7J9L8U3 | 5-93 | None |
| A0A1R3IE56 | 469-570 | None |
| A0A843WB70 | 432-529 | None |
| A0A498JJ09 | 324-413 | None |
| A0A498JDD5 | 317-416 | None |
| F2CX41 | 336-442 | None |
| A0A2G3AHA9 | 498-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.