DPCstruct | MC22054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1545 |
|---|---|
| Mean domain length (aa) | 225 ± 53 aa |
| Standard deviation of domain lengths | 53.11 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.19 |
| Pfam Score | 83.21 |
| Assigned Pfam label(s) | PF03105- PF05216- PF04987- PF17830- PF04770 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6C524 | 7-135 | DRLPTRSRLAAWGLPIAPTCPLCSRYDETRDHLMLSCEYSYEVWSGVMRRCHPPPSRIASWSELLSWIRSSPSKRLTLLRKIAAQTV… |
| A0A2N9EZU7 | 51-292 | LKEGYPDLFRIARDKEALVVDHMCFENGVVSWVLNFTRSAQDWELDSIAAFLKLLYSSSAKGQGEDRLCWQGSASGAFQVKAYYKAL… |
| A0A438DVL1 | 164-389 | None |
| K3X6Y9 | 29-237 | None |
| A0A438DU34 | 128-409 | None |
| A0A438DTJ4 | 50-298 | None |
| A0A438DRP3 | 237-511 | None |
| A0A438DHF4 | 292-502 | None |
| A0A438DH28 | 815-1105 | None |
| A0A438DE88 | 792-1036 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.