DPCstruct | MC22050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4DNG1 | 388-469 | KKLKDPTLRFRLLKHTRLNVVAFLNELPKTLHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFVAVPASN |
| M3Z120 | 2-80 | KKLKDPSLRVQLLKHTKCDVMRSLCVLPKTQHDLSSFVVDMWFQTERMLCFSVNGVFKEVEGMSQDSVRAFTRTFIATP |
| A0A2Y9QDX3 | 199-283 | None |
| A0A183HDI5 | 21-111 | None |
| A0A7F8R457 | 1-83 | None |
| A0A564Y2S0 | 39-137 | None |
| A0A0M4EZ31 | 641-740 | None |
| A0A5F5Y0S5 | 59-148 | None |
| A0A5E4CML5 | 44-139 | None |
| A0A0K2V5W9 | 37-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.