DPCstruct | MC22049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2E0L8 | 10-78 | AELIPSDYASWRYCIEVKCGLALEPDFLRARIAVLSDPGHEETQRFARLYGDTHLNRILAWFRQAAAEA |
| A0A171KPI7 | 1-71 | MPALIPRTYEQWHHCIVRECGIPLTTAFIAQRLATWRNPEAEETRRFRKRYGDAHWQAILAWFEQAAQEAQ |
| A0A1Q3ZGF4 | 1-61 | None |
| A0A2W4VEB3 | 6-82 | None |
| A0A4Q5L505 | 2-70 | None |
| A0A3D4S290 | 7-83 | None |
| A0A517P287 | 4-72 | None |
| F4CFI5 | 21-84 | None |
| A0A1H2NEW7 | 3-61 | None |
| A0A3P8KIN5 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.