DPCstruct | MC22048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3QHZ5 | 58-129 | MSAEPGKVAVSGPAEVAGQKVLTLSFLQGRDPDWVGRPFFAQYDESATWLNELRPAFGEEKFFFEDELAHRY |
| A0A7V7F164 | 1-69 | NPGKIQIMGVSEIRGEKVLALRFLQGRDPDWVQRPFFAGYDQTATWLNELKPAFGEKRFFFEDTLESTY |
| A0A7S3ZVU5 | 106-179 | None |
| S3E083 | 495-568 | None |
| K0RKR6 | 82-144 | None |
| A0A1S3J683 | 327-391 | None |
| A0A661A8T2 | 41-103 | None |
| A0A1Z1WRS6 | 1-58 | None |
| A0A6P5ABN5 | 413-476 | None |
| A0A1A0EVJ0 | 371-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.