DPCstruct | MC22043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 267 ± 37 aa |
| Standard deviation of domain lengths | 37.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7CT58 | 30-276 | CSTLHDITRFCHEKAVHEMFQFGKEHLFPERSSKQLFYEVPMHWWILNLDDGFNEEVKGKYVNLENIASIPMLAFWDGFVAVPWDGP… |
| A0A2M8GGS0 | 3-212 | FWVIDLDDGFRDEAEGRHVKLENISSIPMLALWAGITAIPWRGPPPVNARGFLSILHEATTNPALDPSTRSSYAVRNYFMISKNFCS… |
| A0A7J0BMA7 | 707-993 | None |
| A0A2N2GNE4 | 561-852 | None |
| A0A3B9YHM5 | 73-327 | None |
| A0A7J5WJA5 | 9-201 | None |
| A0A2H6HWL6 | 2-214 | None |
| A0A7X8GHM4 | 557-846 | None |
| E1JS92 | 103-389 | None |
| A0A1X7C1R0 | 397-649 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.