DPCstruct | MC22039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524QUX9 | 4-81 | FECPGCKYGHVLDTAPGKWSWNGDFVKPTASPSLFVNQKGNPKYPKCHFFIKNGQLEFCGDTTHELAGQTVPMAPWED |
| A0A351XVL8 | 13-83 | VFHCPGCNAIHVIDSRWSFNENVDMPTISPSLLVRWPDHVCHSFIREGKIQFLSDCTHKLKGQTVEIPDFE |
| A0A3N5S2D4 | 11-87 | None |
| A0A4Q3F3Q6 | 42-121 | None |
| A0A537JXY4 | 3-97 | None |
| A0A1G8I9N1 | 8-78 | None |
| A0A6G8G4H1 | 4-93 | None |
| G9Y3S5 | 1-79 | None |
| A0A166RKQ6 | 17-113 | None |
| A0A4Q3AC50 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.