DPCstruct | MC22038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 284 |
|---|---|
| Mean domain length (aa) | 222 ± 52 aa |
| Standard deviation of domain lengths | 51.73 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0292- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8I8I2 | 144-460 | FSRRNAPSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASPAALTRKIGGTALGAALAERFGPSV… |
| A0A524KMC4 | 40-235 | LKTGPFTADGRATTLREQALEAAMLHLLDGAADRPGERLPTAGELDAIVAFEETMREPETGGLGLNLKTAKAREGHKLFFGAARCTA… |
| A0A7V9BUM2 | 2-158 | None |
| A0A3D4BVU9 | 14-190 | None |
| A0A2H5A2B6 | 95-353 | None |
| A0A2E0WMN0 | 199-362 | None |
| A0A2G2M050 | 207-469 | None |
| A0A517YDJ4 | 559-766 | None |
| A0A534HNR9 | 333-571 | None |
| A0A7V3DXK3 | 442-616 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.