DPCstruct | MC22035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 42.88 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF15075- PF10197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267ETC2 | 10-145 | RANPKVGSVIPPYNAQKDNYVKTYFDFIGVKKTLNKNKQNPPGTCVEGPAMERFFTSGHGKQYLTPRNERQGNGYSNEERMGHGKLW… |
| A0A401T4G9 | 38-164 | GYGRVNPKRCDVIPPYNAQADPYIKFSFYNNYMRKLLKRTNQDYGGTSSNGWLVDYFYKYGPAQRYLHKRNMYGAGHSYDQIVGHRG… |
| A0A1L8ES07 | 123-244 | None |
| A0A1U7SNS1 | 1-115 | None |
| A0A7I8VX34 | 368-498 | None |
| A0A7M7MYG3 | 245-392 | None |
| A0A6P4Z888 | 211-338 | None |
| A0A814Z4J2 | 84-210 | None |
| A0A674BCY2 | 1-157 | None |
| A0A7J7EKD3 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.