DPCstruct | MC22034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836TEH4 | 21-90 | NRLFGVMNNQLYAHPYLAGDAYTIADMISYPWAVLWESQGQDINEFKHVKRWIDELGERPAVQKGMAVGS |
| A0A377WNX8 | 1-67 | MLNQRLGCSPWLGGDHYSIADIAAWPWVNCHVRQRIDLANYPAVHNWYERIKQRPATAEAMLKIQLY |
| F4XZJ8 | 29-96 | None |
| A0A7W5ZST5 | 69-128 | None |
| A0A7C5LQC7 | 76-145 | None |
| A0A840XZU2 | 74-140 | None |
| A0A2G8PE94 | 2-76 | None |
| A0A1F9J916 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.