DPCstruct | MC22032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 59.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377WK71 | 1-156 | MPPVWRRHPQWRLPVDDGLVSQVRTRLIRQMGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFTRQAWEQ… |
| A0A2X1QC18 | 178-322 | LASHPQWRLPVDDGLVSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFTRQAWEQAVQP… |
| A0A2X3IM73 | 2-137 | None |
| A0A4Q4WP38 | 3-128 | None |
| A0A377XBL2 | 392-542 | None |
| A0A377VCM9 | 1-157 | None |
| A0A530M978 | 359-512 | None |
| A0A0Q3E0W1 | 294-443 | None |
| A0A377TUU9 | 248-399 | None |
| K8CAT8 | 163-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.