DPCstruct | MC22031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 552 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 94.03 |
| Assigned Pfam label(s) | CL0257- CL0123- CL0020- CL0310- CL0311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5GMR7 | 75-181 | GLPAQMSVDEVATAAGYIIGKKGGAPDGSRVEVNLTGPVEAMVRVAVDGRASVVESFDDGPTCTLSMSSHDWLALTGGRKDPVPLIN… |
| A0A377WDU3 | 13-112 | TALNTFLWRDKALKPARQRLLGKVLRVQLQDFATPVVLVFSERQVDVLSAWDGEADCTVITRLSVLPKLRNRQQLTALIRSGDLEVQ… |
| A0A523AR01 | 59-179 | None |
| A0A418WF28 | 9-134 | None |
| A0A7S1Y064 | 133-275 | None |
| A0A3D3Q5G5 | 11-95 | None |
| A0A3D0I5J0 | 653-774 | None |
| A0A438MVN4 | 38-143 | None |
| A0A7C5UVB9 | 904-1021 | None |
| A0A2U8G852 | 9-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.