DPCstruct | MC22026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377VTK8 | 1-87 | MPFCEAVHNVMTNTLLPPDSKGVMVALRPAPGLRVEQALTLCKPNRMGDIMTIGNNRLVLFLSFCRINDLDTALNHIFPLPTGDIFF |
| A0A377US72 | 52-136 | FCEAVHNVMTNTLLPPDSKGVMVALRPAPGLRVEQALTLCKPNRMGDIMTIGNNRLVLFLSFCRINDLDTALNHIFPLPTGDIFS |
| A0A376TXK0 | 191-275 | None |
| A0A090T1R1 | 113-188 | None |
| W1EVG6 | 278-362 | None |
| K8BEP8 | 75-159 | None |
| B8L0X4 | 39-116 | None |
| A0A2X2T2X6 | 75-159 | None |
| A0A485BBS0 | 1-77 | None |
| A0A1C2K9G8 | 3-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.