DPCstruct | MC22025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 150 ± 26 aa |
| Standard deviation of domain lengths | 25.66 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.90 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.98 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0123- PF08364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485D938 | 1-108 | MQGFANRADDSVTAQEKQTLLTHLNREHGSAPDKLTLQRKTRSTLNIPGTGGKSKSVQIEVRKKRTFVKRDPQEAERLAAEEQAQRE… |
| A0A377WPW6 | 1-153 | MTDVTIKALASEIQTSVDRLIQQFADAGIRKSADDSVTSQEKQTLLTHLNREHGSAPDKLTLQRKTRSTLNIPGTGGKSKSVQIEVR… |
| A0A090SZZ5 | 2-105 | None |
| D1KAN3 | 1-147 | None |
| A0A6L7KWK2 | 1-148 | None |
| A0A7R9QVA2 | 1-153 | None |
| A0A2X2BPY0 | 2-133 | None |
| A0A378AGR7 | 1-153 | None |
| A3RXC9 | 1-174 | None |
| C0B0G1 | 15-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.