DPCstruct | MC22021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 2.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 55.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1PX27 | 1-55 | MTKQILLVSQREADLEEPTPEDLFDVGTIANIIQLLKLPDGTVKVLVEGQNRAKN |
| A0A377UYB8 | 1-61 | MDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGAAACSHFCAV |
| S7V8Y3 | 68-121 | None |
| W9T9W7 | 514-565 | None |
| A0A2A2M5J5 | 1-54 | None |
| A0A7H4NPR6 | 45-99 | None |
| A0A0H4T1T6 | 59-109 | None |
| A0A183BXS7 | 464-515 | None |
| A0A7C6WGZ5 | 44-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.