DPCstruct | MC22020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377UX04 | 1-51 | MKTEQLIPLCRRYHAMLLHSDEQTISIAVVNTPPAELMEALRFATQKRIDI |
| A0A810ZNG6 | 5-68 | TQRALEAICHRYQAVIIECNPQRLHIALADSPSHEMMTELRFATHSAINVECWPQARLEQFSRQ |
| A0A2X2SWN7 | 1-64 | None |
| A0A484YLB1 | 1-63 | None |
| A0A377XLJ4 | 1-62 | None |
| J9JSE8 | 594-651 | None |
| A0A143HYB7 | 1-62 | None |
| A0A3S4IZ64 | 1-63 | None |
| A0A4U9DDE4 | 1-63 | None |
| A0A0I1PFP8 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.