DPCstruct | MC2202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.27 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0265- PF05652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238FAM3 | 195-294 | RASPDAQITSICPASEKHIRKYSQQITRIVRETPELYETVVEPYIKYLDPNQISWVYNILDGISEAEHVILRDDDPDTGFVLTPDLK… |
| A0A1L8FL39 | 2-86 | KTTVICPASEKHIKKYLQQEVYVIHETEDDYKAITLPYIESQSFSIQWVYNILEKKAEAERIVYENPDPTNGFVLIPDFKWNQKQ |
| C9S675 | 109-194 | None |
| A0A0D0SZ47 | 99-179 | None |
| A0A0R3QBU8 | 1-86 | None |
| A0A0C9MY99 | 778-867 | None |
| A0A0V0S8J0 | 820-912 | None |
| A0A5N4C7Y6 | 31-115 | None |
| A0A1I8BL59 | 19-106 | None |
| A0A4Q1BTV9 | 48-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.