DPCstruct | MC22019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523Q1F6 | 25-105 | ISLEKVPMLDPAWLMKLPKGQAFALLEGGRLMKIRIPLPLPHVDARTPANWQAMLSHMRMLQTQQTDRSPERDLTVEGKGS |
| A0A7Y9NC26 | 1-77 | MPLIEPAHVVALPKGQAFALIEGGHLWKVRMPLPAPDPDKAMPANLQALAGHMRQHYVEAGEWWEQVGPSATGDDLP |
| A0A1T2CG25 | 45-133 | None |
| A0A011MSV0 | 145-220 | None |
| A0A7Z1BJZ1 | 185-271 | None |
| A0A109C9N9 | 1-92 | None |
| A0A3U2KPX5 | 2-71 | None |
| A0A4U9UWD4 | 40-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.