DPCstruct | MC22015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 258 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 86.28 |
| Assigned Pfam label(s) | CL0023- CL0437- CL0329- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844JKU9 | 1-82 | MFKYIENADPMQQKQLAKGIDQLMDEGVAQLFVNQFNGRKIIGTVGQLQFEVIQYRLENEYSAKCRWEPLSLYKACWIESDD |
| A0A150GJS3 | 1-95 | MSLALTPTSAEQFPTFMKALQRFQKEDPTFRVSSNAATGEIIVSGMGELHLEVYIERIRREYKVTCEVGKPKVAYREALTGRAEFSY… |
| A0A1R3KGV7 | 358-469 | None |
| A0A0C2JYV3 | 2-101 | None |
| M5JM90 | 257-328 | None |
| A0A6S7FH92 | 3-96 | None |
| A0A7R9KJ60 | 452-547 | None |
| A0A287XA67 | 569-649 | None |
| A0A2I0I9G7 | 291-378 | None |
| A0A397EKC9 | 597-684 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.