DPCstruct | MC22012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 284 ± 32 aa |
| Standard deviation of domain lengths | 32.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150GH30 | 1-269 | MRFFDDNTRSWWTPATGGANVPALNDLLAPFGLGLGDAVVHGTAAIAGMRVTLSYGVDVAKVPAGGWLHKATLSDAARKGSHPSSHG… |
| A0A7E4RVB3 | 185-414 | MKKVKFFDENTRQWWMPDTGGANVPALNDLLSSWGIVLGDIVYDGDYTIGKQTVSYSSGSHIARFPSKGTVLSAKLTDQGNEILGGR… |
| A0A183KB78 | 54-383 | None |
| A0A820XZW8 | 1-310 | None |
| A0A444EQ09 | 213-470 | None |
| A0A0L0BW23 | 126-456 | None |
| F2UDW3 | 875-1158 | None |
| A0A7S2F9U8 | 13-312 | None |
| A0A072UCD4 | 157-478 | None |
| A0A2G9PQC2 | 300-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.