DPCstruct | MC2201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 3.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 64.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7URQ2 | 59-115 | FRSKQLIKDAIMENDFLKNLDSSQVREVVDCMYPQVFEAGTLVIRERDVGSHLYVSA |
| A0A1L8FIQ3 | 1-55 | SKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVME |
| B4JQH6 | 503-562 | None |
| A0A811UTF6 | 217-275 | None |
| A0A834JSF3 | 86-143 | None |
| A0A7R9AJG3 | 144-201 | None |
| A0A6P8US98 | 104-162 | None |
| L5JQD5 | 2-60 | None |
| J9K1F1 | 200-256 | None |
| A0A6A5E6Q4 | 100-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.