DPCstruct | MC22006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150G8X6 | 1-80 | MTGGDCSGYTGMSCDCSYRKGGCYITRLPPASAACNCKYRGFWTCSGEVTRCRDPNSPYCTSPGFNQPTCQQGGGDCGAY |
| A0A822GKT0 | 99-168 | SPNKCDCDYHPGGCTISWPAPSGKACKCEYKGAWTCGGSLVSCDISRSKCFKPDESKEACQLGQGDCDAY |
| A0A815C3G4 | 167-242 | None |
| E9FQQ6 | 307-376 | None |
| A0A817GGJ4 | 271-335 | None |
| A0A819H114 | 738-810 | None |
| A0A818SNK1 | 264-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.