DPCstruct | MC22004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 240 ± 39 aa |
| Standard deviation of domain lengths | 38.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835VW54 | 263-495 | PAGGGSGGPPSVVAVSTGAQLVAALADPGKAGVLLLNDVALSDSDFSCLGLPLPRATNFTITGSQSSANPAIYPVLDLGFVKSKVRL… |
| A0A150G4G2 | 11-296 | GLVRNISSGAEYAAAFNDPSVSTVLVTADLALSADDWDPYPSPVVLTRNVTLLGAYDEPTRWPVVDMAYVRAKMQLAPGVVFNASRL… |
| D8UAA5 | 114-410 | None |
| D8U1K2 | 161-382 | None |
| D8TMV9 | 33-271 | None |
| A0A0D2M2X3 | 3-222 | None |
| A8HM79 | 18-327 | None |
| A8IU96 | 60-323 | None |
| A0A150GMS0 | 3-181 | None |
| D8UCA2 | 39-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.