DPCstruct | MC22001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 500 ± 40 aa |
| Standard deviation of domain lengths | 39.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150GEQ5 | 1-494 | MYSSSLQLLAHNCIIVACDLAMASSPDEEPQQRELFAALVAALEDSRVLEHTARAVLLHTCNTRALRALMPHSVLVAARGHVDLWRL… |
| A0A150G2R7 | 1-523 | MQASTASLSVGLTDLVLLECSRRHDSPLSPPICARLSSLLRSHLLQAAGRQLALVVDHLADLEPGQWAGGWIITYAVSVVNLICFLI… |
| A0A836BWL1 | 42-581 | None |
| A0A150G720 | 3-419 | None |
| A0A150GEI6 | 60-573 | None |
| A0A835XJ06 | 36-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.