DPCstruct | MC22000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06011 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150G1I5 | 1-108 | MIAVFILYPGWTQAALSVFACYRIDDGSGPFPDRQQATWRYGYWIRDMQQACYTGRHLGLYVPIGVISVALTCFLPPLLSFLLLWRN… |
| A0A150GBG2 | 186-298 | IAVFILYPGWAQAALSVFACYLIDDRSGPFPDQQQATWRYGYWIRDMAQECYSGVHLSLYVPIGIAAVILVCFGPPIGSFALLWRHQ… |
| A0A835XGF7 | 1-122 | None |
| A0A2J7ZUM7 | 424-536 | None |
| A0A2J7ZT83 | 141-253 | None |
| A0A2J8AFT9 | 213-316 | None |
| A0A150GBH0 | 4-117 | None |
| A0A150GBG8 | 436-542 | None |
| A0A150G851 | 205-318 | None |
| A0A150G1D0 | 96-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.