DPCstruct | MC2200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A013VI61 | 84-176 | TDCAITPGELASLLERACFYPDEDSDADSYHTQQAAFDMQARFTANLLLLGEDAAIIERVREAMREHVSWLIPKDRAIAVRAVNYQV… |
| A0A1B3ZEE3 | 1-121 | MIMTNLSHQQLSAILAPVDEATILFDSEADVQPGALADLIYASLFRYADNHESDSWETQSLASERQALNLANELLLGEDEALHAQLR… |
| A0A6N8XQZ5 | 184-278 | None |
| A0A1V4BYJ5 | 1-103 | None |
| A0A1E4MVK4 | 223-316 | None |
| A0A5E7ZDV2 | 358-461 | None |
| A0A7X4HV16 | 511-609 | None |
| A0A4R6FH61 | 48-151 | None |
| A0A7K1YUU7 | 128-222 | None |
| A0A6A7BRQ6 | 460-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.