DPCstruct | MC220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 250 ± 51 aa |
| Standard deviation of domain lengths | 50.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0PMP2 | 1-216 | MLDKAPIYEVPASALTSPPQGTPRNPKKLMIEEPSYFIFNVAMSAAWGTTPPNVFMGGCRGDKNYPQPGTFEYNITNNICDSFPMYM… |
| A0A6A4DQZ9 | 433-679 | GPSGYVRWMLDGDPLYEIPAETITTPPQGADTDLKNPRKIMIEEPLYLIFNVAMSSKWGAQPPNPRNPCRGDGTDPVANRICDSFPM… |
| A0A397F3F7 | 335-609 | None |
| A0A067C1C0 | 1-164 | None |
| K3X0H4 | 272-538 | None |
| W2Q4Z8 | 573-843 | None |
| V9DS61 | 64-339 | None |
| A0A418AXL5 | 962-1237 | None |
| A0A6G0QMG8 | 1-222 | None |
| A0A482SU27 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.